PDB entry 1ct1

View 1ct1 on RCSB PDB site
Description: cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide
Deposited on 1997-06-03, released 1997-10-15
The last revision prior to the SCOP 1.67 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.67: d1ct1d_
  • Chain 'E':
    Domains in SCOP 1.67: d1ct1e_
  • Chain 'F':
    Domains in SCOP 1.67: d1ct1f_
  • Chain 'G':
    Domains in SCOP 1.67: d1ct1g_
  • Chain 'H':
    Domains in SCOP 1.67: d1ct1h_

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1D (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1E (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1F (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1G (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ct1H (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman