PDB entry 1ct1

View 1ct1 on RCSB PDB site
Description: cholera toxin b-pentamer mutant g33r bound to receptor pentasaccharide
Class: enterotoxin
Keywords: enterotoxin, toxin-receptor complex, oligosaccharide
Deposited on 1997-06-03, released 1997-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'D':
  Compound: cholera toxin
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1ct1d_
• Chain 'E':
  Compound: cholera toxin
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1ct1e_
• Chain 'F':
  Compound: cholera toxin
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1ct1f_
• Chain 'G':
  Compound: cholera toxin
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1ct1g_
• Chain 'H':
  Compound: cholera toxin
  Species: Vibrio cholerae [TaxId:666]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01556 (0-102)
    • conflict (17)
    • engineered (32)
    • conflict (46)
  Domains in SCOPe 2.08: d1ct1h_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ct1D (D:)
  tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ct1E (E:)
  tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ct1F (F:)
  tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ct1G (G:)
  tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ct1H (H:)
  tpqnitdlcaeyhntqihtlndkifsyteslarkremaiitfkngatfqvevpgsqhids
  qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman