PDB entry 1csv

View 1csv on RCSB PDB site
Description:
Deposited on 1994-10-04, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1csv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csv_ (-)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafggfkkekdrndlitylkkate