PDB entry 1csu

View 1csu on RCSB PDB site
Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c
Deposited on 1994-10-04, released 1995-01-26
The last revision prior to the SCOP 1.69 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 1.81 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1csu__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1csu_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafggckkekdrndlitylkkate