PDB entry 1csu

View 1csu on RCSB PDB site
Description: replacements in a conserved leucine cluster in the hydrophobic heme pocket of cytochrome c
Class: electron transport(heme protein)
Keywords: electron transport(heme protein)
Deposited on 1994-10-04, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (89)
      • conflict (106)
    Domains in SCOPe 2.08: d1csua_
  • Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csuA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafggckkekdrndlitylkkate