PDB entry 1csr

View 1csr on RCSB PDB site
Description: Alpha-fluoro acid and alpha-fluoro amide analogs of acetyl-coa as inhibitors of of citrate synthase: effect of pka matching on binding affinity and hydrogen bond length
Class: oxo-acid-lyase
Keywords: oxo-acid-lyase
Deposited on 1995-08-04, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23007 (0-430)
      • conflict (6)
      • conflict (9)
      • conflict (29)
      • conflict (38)
      • conflict (49)
      • conflict (66)
      • conflict (74)
      • conflict (79)
      • conflict (101)
      • conflict (107)
      • conflict (160)
      • conflict (167-168)
      • conflict (172)
      • conflict (193)
      • conflict (219)
      • conflict (280)
      • conflict (283)
      • conflict (288-289)
      • conflict (291)
      • conflict (293)
      • conflict (340)
      • conflict (425)
      • conflict (428)
    Domains in SCOPe 2.07: d1csra_
  • Heterogens: OAA, FAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csrA (A:)
    stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
    girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
    hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
    pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
    vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
    dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
    eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
    ksmstagleklsagg