PDB entry 1csq

View 1csq on RCSB PDB site
Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-05-12, released 1995-05-12
The last revision prior to the SCOP 1.73 freeze date was dated 1995-05-12, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cold shock protein b(cspb)
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1csqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csqA (A:)
    mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtkea