PDB entry 1csp

View 1csp on RCSB PDB site
Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Deposited on 1993-05-12, released 1995-05-12
The last revision prior to the SCOP 1.71 freeze date was dated 1995-05-12, with a file datestamp of 1995-05-18.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1csp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csp_ (-)
    mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtkea