PDB entry 1csp

View 1csp on RCSB PDB site
Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
Class: transcription regulation
Keywords: transcription regulation
Deposited on 1993-05-12, released 1995-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cold shock protein b(cspb)
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32081 (0-66)
  Domains in SCOPe 2.08: d1cspa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cspA (A:)
  mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
  anvtkea