PDB entry 1csn

View 1csn on RCSB PDB site
Description: binary complex of casein kinase-1 with mgatp
Deposited on 1995-04-25, released 1995-07-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1csn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csn_ (-)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll