PDB entry 1csn

View 1csn on RCSB PDB site
Description: binary complex of casein kinase-1 with mgatp
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1995-04-25, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase-1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40233 (Start-297)
      • conflict (81)
    Domains in SCOPe 2.07: d1csna_
  • Heterogens: MG, SO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1csnA (A:)
    msgqnnvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtyk
    llagctgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvq
    sihekslvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsg
    tarymsinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqst
    plrelcagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1csnA (A:)
    nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
    tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
    slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
    sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
    cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll