PDB entry 1csm

View 1csm on RCSB PDB site
Description: the crystal structure of allosteric chorismate mutase at 2.2 angstroms resolution
Class: isomerase
Keywords: isomerase
Deposited on 1994-08-22, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32178 (0-255)
      • conflict (225)
    Domains in SCOPe 2.07: d1csma_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32178 (0-255)
      • conflict (225)
    Domains in SCOPe 2.07: d1csmb_
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdptnesgerriipeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1csmA (A:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterriipeylvkiykeivipitke
    veveyllrrlee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1csmB (B:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdptnesgerriipeylvkiykeivip
    itkeveveyllrrlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1csmB (B:)
    mdftkpetvlnlqnirdelvrmedsiifkfiershfatcpsvyeanhpgleipnfkgsfl
    dwalsnleiahsrirrfespdetpffpdkiqksflpsinypqilapyapevnyndkikkv
    yiekiipliskrdgddknnfgsvatrdieclqslsrrihfgkfvaeakfqsdiplytkli
    kskdvegimknitnsaveekilerltkkaevygvdpterriipeylvkiykeivipitke
    veveyllrrlee