PDB entry 1csk

View 1csk on RCSB PDB site
Description: the crystal structure of human csksh3: structural diversity near the rt-src and n-src loop
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-03-22, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-src sh3 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cska_
  • Chain 'B':
    Compound: c-src sh3 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cskb_
  • Chain 'C':
    Compound: c-src sh3 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cskc_
  • Chain 'D':
    Compound: c-src sh3 domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cskd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cskA (A:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cskA (A:)
    gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cskB (B:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cskB (B:)
    gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cskC (C:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cskC (C:)
    gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cskD (D:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cskD (D:)
    gteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyvqkr