PDB entry 1csj

View 1csj on RCSB PDB site
Description: crystal structure of the RNA-dependent RNA polymerase of hepatitis c virus
Class: transferase
Keywords: polyprotein, glycoprotein, RNA-directed RNA polymerase, core protein, coat protein, envelope protein, helicase, ATP-binding, transmembrane, nonstructural protein, transferase
Deposited on 1999-08-18, released 1999-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatitis c virus RNA polymerase (ns5b)
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csja_
  • Chain 'B':
    Compound: hepatitis c virus RNA polymerase (ns5b)
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csjA (A:)
    smsytwtgalitpcaaeesklpinalsnsllahhnmvyattsrsaglrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
    svwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
    tlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiy
    qccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkas
    aacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydl
    elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
    armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspg
    einrvasclrklgvpplrvwrhrarsvraallsqggraatcgkylfnwavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csjB (B:)
    smsytwtgalitpcaaeesklpinalsnsllahhnmvyattsrsaglrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
    svwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
    tlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiy
    qccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkas
    aacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydl
    elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
    armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspg
    einrvasclrklgvpplrvwrhrarsvraallsqggraatcgkylfnwavk