PDB entry 1csh

View 1csh on RCSB PDB site
Description: A very short hydrogen bond provides only moderate stabilization of an enzyme: inhibitor complex of citrate synthase
Class: lyase(oxo-acid)
Keywords: lyase(oxo-acid)
Deposited on 1994-03-07, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23007 (0-430)
      • conflict (6)
      • conflict (9)
      • conflict (29)
      • conflict (38)
      • conflict (49)
      • conflict (66)
      • conflict (74)
      • conflict (79)
      • conflict (101)
      • conflict (107)
      • conflict (160)
      • conflict (167-168)
      • conflict (172)
      • conflict (193)
      • conflict (219)
      • conflict (280)
      • conflict (283)
      • conflict (288-289)
      • conflict (291)
      • conflict (293)
      • conflict (340)
      • conflict (425)
      • conflict (428)
    Domains in SCOPe 2.07: d1csha_
  • Heterogens: OAA, AMX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cshA (A:)
    stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
    girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
    hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
    pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
    vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
    dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
    eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
    ksmstagleklsagg