PDB entry 1csc

View 1csc on RCSB PDB site
Description: Structure of ternary complexes of citrate synthase with D-and L-malate: Mechanistic implications
Class: oxo-acid-lyase
Keywords: oxo-acid-lyase
Deposited on 1990-05-07, released 1991-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csca_
  • Heterogens: CMC, LMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cscA (A:)
    asstnlkdvlaalipkeqariktfrqqhggtalgqitvdmsyggmrgmkglvyetsvldp
    degirfrgfsipecqkllpkggxggeplpeglfwllvtgqiptgaqvswlskewakraal
    pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegilrtkywemvyesamdlia
    klpcvaakiyrnlyragssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
    gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlgwlaqlqkaxxxagadas
    lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpgdpmfklvaqlykivpnv
    lleqgaaanpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
    rpksmstdglial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cscA (A:)
    asstnlkdvlaalipkeqariktfrqqhggtalgqitvdmsyggmrgmkglvyetsvldp
    degirfrgfsipecqkllpkggggeplpeglfwllvtgqiptgaqvswlskewakraalp
    shvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegilrtkywemvyesamdliak
    lpcvaakiyrnlyragssigaidskldwshnftnmlgytdaqftelmrlyltihsdhegg
    nvsahtshlvgsalsdpylsfaaamnglagplhglanqevlgwlaqlqkaagadaslrdy
    iwntlnsgrvvpgyghavlrktdprytcqrefalkhlpgdpmfklvaqlykivpnvlleq
    gaaanpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerpks
    mstdglial