PDB entry 1csb

View 1csb on RCSB PDB site
Description: Crystal structure of cathepsin b inhibited with CA030 at 2.1 angstroms resolution: A basis for the design of specific epoxysuccinyl inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: PAPAIN-LIKE LYSOSOMAL DICARBOXY-PEPTIDASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1994-12-09, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CATHEPSIN B light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csb.1
  • Chain 'B':
    Compound: CATHEPSIN B heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csb.1
  • Chain 'D':
    Compound: CATHEPSIN B light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csb.2
  • Chain 'E':
    Compound: CATHEPSIN B heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1csb.2
  • Heterogens: EP0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csbA (A:)
    lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csbB (B:)
    vsvevsaedlltccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippce
    hhvngsrppctgegdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngp
    vegafsvysdfllyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdng
    ffkilrgqdhcgiesevvagiprtd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csbD (D:)
    lpasfdareqwpqcptikeirdqgscgscwafgaveaisdricihtn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1csbE (E:)
    vsvevsaedlltccgsmcgdgcnggypaeawnfwtrkglvsgglyeshvgcrpysippce
    hhvngsrppctgegdtpkcskicepgysptykqdkhygynsysvsnsekdimaeiykngp
    vegafsvysdfllyksgvyqhvtgemmgghairilgwgvengtpywlvanswntdwgdng
    ffkilrgqdhcgiesevvagiprtd