PDB entry 1cs8

View 1cs8 on RCSB PDB site
Description: crystal structure of procathepsin l
Class: hydrolase
Keywords: prosegment, propeptide, inhibition, hydrolase
Deposited on 1999-08-17, released 1999-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human procathepsin l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07711 (96-315)
      • modified residue (120)
      • engineered (205)
    Domains in SCOPe 2.07: d1cs8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs8A (A:)
    sltfdhsleaqwtkwkamhnrlygmneegwrravweknmkmielhnqeyregkhsftmam
    nafgdmtseefrqvmngfqnrkprkgkvfqeplfyeaprsvdwrekgyvtpvknqgqcgs
    cwafsatgalegqmfrktgrlislseqnlvdcsgpqgnegcngglmdyafqyvqdnggld
    seesypyeateesckynpkysvandagfvdipkqekalmkavatvgpisvaidaghesfl
    fykegiyfepdcssedmdhgvlvvgygfestesdnnkywlvknswgeewgmggyvkmakd
    rrnhcgiasaasyptv