PDB entry 1cs3

View 1cs3 on RCSB PDB site
Description: structure of btb/poz transcription repression domain from promelocytic leukemia zinc finger oncoprotein
Class: transcription
Keywords: btb/poz, plzf, transcription repression, oncoprotein, gene regulation, transcription
Deposited on 1999-08-16, released 1999-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: zinc finger protein plzf
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q05516 (0-115)
  Domains in SCOPe 2.08: d1cs3a_
• Heterogens: MG, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cs3A (A:)
  gmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhrn
  sqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkml