PDB entry 1cs1

View 1cs1 on RCSB PDB site
Description:
Deposited on 1998-09-23, released 1999-09-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-27, with a file datestamp of 1999-09-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cs1a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cs1b_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cs1c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1cs1d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs1A (A:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs1B (B:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs1C (C:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cs1D (D:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg