PDB entry 1cs1

View 1cs1 on RCSB PDB site
Description: cystathionine gamma-synthase (cgs) from escherichia coli
Class: lyase
Keywords: lyase, llp-dependent enzymes, methionine biosynthesis
Deposited on 1998-09-23, released 1999-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.2
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cystathionine gamma-synthase)
    Species: Escherichia coli [TaxId:562]
    Gene: METB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00935 (Start-385)
      • modified residue (197)
    Domains in SCOPe 2.07: d1cs1a_
  • Chain 'B':
    Compound: protein (cystathionine gamma-synthase)
    Species: Escherichia coli [TaxId:562]
    Gene: METB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00935 (Start-385)
      • modified residue (197)
    Domains in SCOPe 2.07: d1cs1b_
  • Chain 'C':
    Compound: protein (cystathionine gamma-synthase)
    Species: Escherichia coli [TaxId:562]
    Gene: METB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00935 (Start-385)
      • modified residue (197)
    Domains in SCOPe 2.07: d1cs1c_
  • Chain 'D':
    Compound: protein (cystathionine gamma-synthase)
    Species: Escherichia coli [TaxId:562]
    Gene: METB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00935 (Start-385)
      • modified residue (197)
    Domains in SCOPe 2.07: d1cs1d_
  • Heterogens: DHD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cs1A (A:)
    mtrkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqra
    laeleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvl
    fvdqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspa
    lqnplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsyl
    llrglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgaml
    sfeldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetll
    ristgiedgedliadlengfraankg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cs1A (A:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cs1B (B:)
    mtrkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqra
    laeleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvl
    fvdqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspa
    lqnplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsyl
    llrglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgaml
    sfeldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetll
    ristgiedgedliadlengfraankg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cs1B (B:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cs1C (C:)
    mtrkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqra
    laeleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvl
    fvdqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspa
    lqnplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsyl
    llrglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgaml
    sfeldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetll
    ristgiedgedliadlengfraankg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cs1C (C:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1cs1D (D:)
    mtrkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqra
    laeleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvl
    fvdqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspa
    lqnplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsyl
    llrglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgaml
    sfeldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetll
    ristgiedgedliadlengfraankg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cs1D (D:)
    rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqrala
    eleggagavltntgmsaihlvttvflkpgdllvaphdcyggsyrlfdslakrgcyrvlfv
    dqgdeqalraalaekpklvlvespsnpllrvvdiakichlarevgavsvvdntflspalq
    nplalgadlvlhsctkylnghsdvvagvviakdpdvvtelawwannigvtggafdsylll
    rglrtlvprmelaqrnaqaivkylqtqplvkklyhpslpenqgheiaarqqkgfgamlsf
    eldgdeqtlrrflgglslftlaeslggveslishaatmthagmapearaaagisetllri
    stgiedgedliadlengfraankg