PDB entry 1crz

View 1crz on RCSB PDB site
Description: crystal structure of the e. coli tolb protein
Class: toxin binding protein
Keywords: two domains: beta propeller and alpha/beta fold, toxin binding protein
Deposited on 1999-08-16, released 2000-08-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.238
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tolb protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A855 (0-402)
      • modified residue (175)
      • modified residue (245)
      • modified residue (318)
      • modified residue (320)
      • modified residue (360)
      • modified residue (369)
    Domains in SCOPe 2.06: d1crza1, d1crza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crzA (A:)
    dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
    paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
    asdevfekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspaw
    spdgsklayvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgs
    lnlyvmdlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqri
    twegsqnqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngt
    mviysssqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl