PDB entry 1cry

View 1cry on RCSB PDB site
Description: application of an automatic molecular replacement procedure to crystal structure of cytochrome c2 from rhodopseudomonas viridis
Class: electron transport(heme protein)
Keywords: electron transport(heme protein)
Deposited on 1993-12-27, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crya_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cryA (A:)
    qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
    evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk