PDB entry 1cry

View 1cry on RCSB PDB site
Description: application of an automatic molecular replacement procedure to crystal structure of cytochrome c2 from rhodopseudomonas viridis
Class: electron transport(heme protein)
Keywords: electron transport(heme protein)
Deposited on 1993-12-27, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c2
  Species: Blastochloris viridis [TaxId:1079]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00083 (0-106)
  Domains in SCOPe 2.08: d1crya_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cryA (A:)
  qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
  evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk