PDB entry 1crx

View 1crx on RCSB PDB site
Description: cre recombinase/DNA complex reaction intermediate I
Class: replication/DNA
Keywords: site-specific recombinase, protein:DNA complex, reaction intermediate, complex (recombinase/DNA), replication/DNA complex
Deposited on 1997-07-02, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crxa1, d1crxa2
  • Chain 'B':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Gene: cre
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crxb1, d1crxb2
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(p*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*gp*c)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3')
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crxA (A:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crxB (B:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.