PDB entry 1crw

View 1crw on RCSB PDB site
Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution
Class: oxidoreductase
Keywords: free-nad gapdh
Deposited on 1999-08-16, released 2000-09-20
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1crwg1, d1crwg2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1crwr1, d1crwr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crwG (G:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crwR (R:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa