PDB entry 1crw

View 1crw on RCSB PDB site
Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution
Class: oxidoreductase
Keywords: free-nad gapdh, oxidoreductase
Deposited on 1999-08-16, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crwg1, d1crwg2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crwr1, d1crwr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crwG (G:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crwR (R:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa