PDB entry 1cru

View 1cru on RCSB PDB site
Description: soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine
Class: oxidoreductase
Keywords: beta-propeller, superbarrel, complex with the cofactor pqq and the inhibitor methylhydrazine, oxidoreductase
Deposited on 1999-08-16, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (soluble quinoprotein glucose dehydrogenase)
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crua_
  • Chain 'B':
    Compound: protein (soluble quinoprotein glucose dehydrogenase)
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crub_
  • Heterogens: CA, PQQ, HDN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cruA (A:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikftykak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cruA (A:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkskelpnqtiirrytyn
    kstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqhtp
    tqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngkll
    qseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkvaa
    gvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykggkk
    aitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvlyvl
    tdtagnvqkddgsvtntlenpgslikft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cruB (B:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikftykak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cruB (B:)
    dvpltpsqfakaksenfdkkvilsnlnkphallwgpdnqiwlteratgkilrvnpesgsv
    ktvfqvpeivndadgqngllgfafhpdfknnpyiyisgtfknpkstdkelpnqtiirryt
    ynkstdtlekpvdllaglpsskdhqsgrlvigpdqkiyytigdqgrnqlaylflpnqaqh
    tptqqelngkdyhtymgkvlrlnldgsipkdnpsfngvvshiytlghrnpqglaftpngk
    llqseqgpnsddeinlivkggnygwpnvagykddsgyayanysaaanksikdlaqngvkv
    aagvpvtkesewtgknfvpplktlytvqdtynyndptcgemtyicwptvapssayvykgg
    kkaitgwentllvpslkrgvifrikldptysttyddavpmfksnnryrdviaspdgnvly
    vltdtagnvqkddgsvtntlenpgslikftyk