PDB entry 1crm

View 1crm on RCSB PDB site
Description: structure and function of carbonic anhydrases
Deposited on 1994-03-04, released 1995-02-07
The last revision prior to the SCOP 1.69 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1crm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1crm_ (-)
    aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
    nvghsfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
    ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
    pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
    mqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1crm_ (-)
    wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
    sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
    sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
    lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
    nrptqplkgrtvrasf