PDB entry 1crl

View 1crl on RCSB PDB site
Description: insights into interfacial activation from an 'open' structure of candida rugosa lipase
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase)
Deposited on 1993-03-02, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.134
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Candida rugosa [TaxId:5481]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1crla_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crlA (A:)
    aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
    mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
    fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
    dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
    sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
    slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
    yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
    yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
    ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv