PDB entry 1cri

View 1cri on RCSB PDB site
Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
Class: electron transport(cytochrome)
Keywords: electron transport(cytochrome)
Deposited on 1993-08-06, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (56)
    • conflict (71)
    • conflict (106)
  Domains in SCOPe 2.08: d1cria_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1criA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
  nvlwdennmsefltnpkkyipgtkmafgglkkekdrndlitylkkate