PDB entry 1crh

View 1crh on RCSB PDB site
Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
Class: electron transport(cytochrome)
Keywords: electron transport(cytochrome)
Deposited on 1993-08-06, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (56)
    Domains in SCOPe 2.06: d1crha_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crhA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace