PDB entry 1crg

View 1crg on RCSB PDB site
Description: the role of a conserved internal water molecule and its associated hydrogen bond network in cytochrome c
Class: electron transport(heme protein)
Keywords: electron transport(heme protein)
Deposited on 1993-08-06, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (56)
    • conflict (106)
  Domains in SCOPe 2.08: d1crga_
• Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1crgA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaiikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate