PDB entry 1crb

View 1crb on RCSB PDB site
Description: crystallographic studies on a family of cellular lipophilic transport proteins. refinement of p2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol
Class: cellular lipophilic transport protein
Keywords: cellular lipophilic transport protein
Deposited on 1993-02-10, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellular retinol binding protein
  Species: Rattus rattus [TaxId:10117]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02696 (0-133)
  Domains in SCOPe 2.08: d1crba_
• Heterogens: CD, RTL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1crbA (A:)
  pvdfngywkmlsnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
  imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
  aegvtckqvfkkvh