PDB entry 1cr9

View 1cr9 on RCSB PDB site
Description: crystal structure of the anti-prion fab 3f4
Class: immune system
Keywords: anti-prion antibody, Fab 3F4, IMMUNE SYSTEM
Deposited on 1999-08-14, released 2000-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CR9 (0-216)
    Domains in SCOPe 2.05: d1cr9h1, d1cr9h2
  • Chain 'L':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1CR9 (0-218)
    Domains in SCOPe 2.05: d1cr9l1, d1cr9l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cr9H (H:)
    kvklqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnsey
    aprfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvts
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cr9L (L:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktyliwvfqrpgqspkrliflvskrd
    sgvpdrftgsgsgtdftlkisrveaedvgvyycwqgthfphtvgggtkleiaradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec