PDB entry 1cr9

View 1cr9 on RCSB PDB site
Description: crystal structure of the anti-prion fab 3f4
Deposited on 1999-08-14, released 2000-04-17
The last revision prior to the SCOP 1.69 freeze date was dated 2000-04-17, with a file datestamp of 2000-04-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cr9H (H:)
    kvklqqsgaelvrsgasvklsctasgfnikdyyiqwvkqrpeqglewigwidpengnsey
    aprfqgkatmtadtlsntaylqlssltsedtavyycnadlhdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkieprvts
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cr9L (L:)
    dvvmtqtplslsvtigqpasisckssqslldsdgktyliwvfqrpgqspkrliflvskrd
    sgvpdrftgsgsgtdftlkisrveaedvgvyycwqgthfphtvgggtkleiaradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec