PDB entry 1cr6

View 1cr6 on RCSB PDB site
Description: crystal structure of murine soluble epoxide hydrolase complexed with cpu inhibitor
Deposited on 1999-08-13, released 1999-11-19
The last revision prior to the SCOP 1.57 freeze date was dated 1999-11-19, with a file datestamp of 1999-11-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cr6A (A:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cr6A (A:)
    rvaafdldgvlalpsigpteqlmkgkitfsqwqifsqamaarsinrpmlqaaialkkkgf
    ttcivtnnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakp
    nevvflddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvsh
    gyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygds
    ssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravasln
    tpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfia
    vhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsck
    glgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqil
    ikwlqte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cr6B (B:)
    rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
    vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
    nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
    ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeaplpvpcnpndvshgyvtvk
    pgirlhfvemgsgpalclchgfpeswfswryqipalaqagfrvlaidmkgygdsssppei
    eeyamellckemvtfldklgipqavfighdwagvmvwnmalfypervravaslntpfmpp
    dpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfksffrasdetgfiavhkate
    iggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwyrnternwkwsckglgrki
    lvpalmvtaekdivlrpemsknmekwipflkrghiedcghwtqiekptevnqilikwlqt
    e