PDB entry 1cr5

View 1cr5 on RCSB PDB site
Description: n-terminal domain of sec18p
Class: endocytosis/exocytosis
Keywords: double-psi beta barrel, vesicle fusion, endocytosis/exocytosis complex
Deposited on 1999-08-13, released 1999-12-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sec18p (residues 22 - 210)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cr5a1, d1cr5a2
  • Chain 'B':
    Compound: sec18p (residues 22 - 210)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cr5b1, d1cr5b2
  • Chain 'C':
    Compound: sec18p (residues 22 - 210)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1cr5c1, d1cr5c2
  • Heterogens: NEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cr5A (A:)
    mdtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigf
    ngnqrtwggwslnqdvqakafdlfkysgkqsylgsididisfrargkavstvfdqdelak
    qfvrcyesqifsptqylimefqghffdlkirnvqaidlgdieptsavatgietkgiltkq
    tqinffkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cr5A (A:)
    trhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfngnq
    rtwggwslnqdvqakafdlfkysgkqsylgsididisfravfdqdelakqfvrcyesqif
    sptqylimefqghffdlkirnvqaidlgdieptsavatgietkgiltkqtqinffkgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cr5B (B:)
    mdtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigf
    ngnqrtwggwslnqdvqakafdlfkysgkqsylgsididisfrargkavstvfdqdelak
    qfvrcyesqifsptqylimefqghffdlkirnvqaidlgdieptsavatgietkgiltkq
    tqinffkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cr5B (B:)
    dtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfn
    gnqrtwggwslnqdvqakafdlfkysgkqsylgsididisfradqdelakqfvrcyesqi
    fsptqylimefqghffdlkirnvqaidlgdieptsavatgietkgiltkqtqinff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1cr5C (C:)
    mdtrtrhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigf
    ngnqrtwggwslnqdvqakafdlfkysgkqsylgsididisfrargkavstvfdqdelak
    qfvrcyesqifsptqylimefqghffdlkirnvqaidlgdieptsavatgietkgiltkq
    tqinffkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cr5C (C:)
    trhlkvsncpnnsyalanvaavspndfpnniyiiidnlfvfttrhsndippgtigfngnq
    rtwggwslnqdvqakafdlfkysgkqsylgsididisfrvfdqdelakqfvrcyesqifs
    ptqylimefqghffdlkirnvqaidlgdieptsavatgietkgiltkqtqinffk