PDB entry 1cr4

View 1cr4 on RCSB PDB site
Description: crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dtdp
Deposited on 1999-08-12, released 1999-11-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-30, with a file datestamp of 2000-06-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cr4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cr4A (A:)
    mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
    tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
    fhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmidnlmtklk
    gfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiialernqqgdm
    pnlvlvrilkcrftgdtgiagymeynketgwlepssy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cr4A (A:)
    mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
    tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
    fhlydsfaeaetdrllaklaymrsglgcdviildhisirkmidnlmtklkgfakstgvvl
    vvichlkdlrggalrqlsdtiialernqlvlvrilkcrftgdtgiagymeynketgwlep
    ssy