PDB entry 1cr1

View 1cr1 on RCSB PDB site
Description: crystal structure of the helicase domain of the gene 4 protein of bacteriophage T7: complex with dttp
Class: transferase
Keywords: reca-type fold, transferase
Deposited on 1999-08-12, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA primase/helicase
    Species: Enterobacteria phage T7 [TaxId:10760]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03692 (0-End)
      • engineered (0)
    Domains in SCOPe 2.07: d1cr1a_
  • Heterogens: SO4, TTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cr1A (A:)
    mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
    tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
    fhlydsfaeaetdrllaklaymrsglgcdviildhisivvsasgesderkmidnlmtklk
    gfakstgvvlvvichlknpdkgkaheegrpvsitdlrgsgalrqlsdtiialernqqgdm
    pnlvlvrilkcrftgdtgiagymeynketgwlepssysgeeeshsestdwsndtdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cr1A (A:)
    mrerirehlsseesvgllfsgctgindktlgarggevimvtsgsgmgkstfvrqqalqwg
    tamgkkvglamleesveetaedliglhnrvrlrqsdslkreiiengkfdqwfdelfgndt
    fhlydsfaeaetdrllaklaymrsglgcdviildhisirkmidnlmtklkgfakstgvvl
    vvichlktdlrgsgalrqlsdtiialernqlvlvrilkcrftgdtgiagymeynketgwl
    epssy