PDB entry 1cqw

View 1cqw on RCSB PDB site
Description: nai cocrystallised with haloalkane dehalogenase from a rhodococcus species
Class: hydrolase
Keywords: a/b hydrolase fold, dehalogenase I-s bond, hydrolase
Deposited on 1999-08-11, released 1999-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase; 1-chlorohexane halidohydrolase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59336 (0-289)
      • conflict (168)
      • conflict (205)
      • conflict (288)
      • insertion (290-294)
    Domains in SCOPe 2.08: d1cqwa_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1cqwA (A:)
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegvlpkcvvrplte
vemdhyrepflkpvdreplwrfpneipiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpglasglg