PDB entry 1cqt

View 1cqt on RCSB PDB site
Description: crystal structure of a ternary complex containing an oca-b peptide, the oct-1 pou domain, and an octamer element
Class: gene regulation/DNA
Keywords: pou domain, protein-DNA complex, oct1, oca-b, protein-DNA interface, gene regulation/DNA
Deposited on 1999-08-11, released 1999-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.264
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pou domain, class 2, transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqta1, d1cqta2
  • Chain 'B':
    Compound: pou domain, class 2, transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqtb1, d1cqtb2
  • Chain 'I':
    Compound: pou domain, class 2, associating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: pou domain, class 2, associating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: DNA (5'-d(*tp*gp*tp*ap*tp*gp*cp*ap*ap*ap*tp*ap*ap*gp*g)-3')
  • Chain 'N':
    Compound: DNA (5'-d(*ap*cp*cp*tp*tp*ap*tp*tp*tp*gp*cp*ap*tp*ap*c)-3')
  • Chain 'O':
    Compound: DNA (5'-d(*tp*gp*tp*ap*tp*gp*cp*ap*ap*ap*tp*ap*ap*gp*g)-3')
  • Chain 'P':
    Compound: DNA (5'-d(*ap*cp*cp*tp*tp*ap*tp*tp*tp*gp*cp*ap*tp*ap*c)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqtA (A:)
    gsreepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsf
    knmcklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvalek
    sflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqtA (A:)
    epsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmc
    klkpllekwlndaerkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirv
    wfcnrrqkekrinp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cqtB (B:)
    gsreepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsf
    knmcklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvalek
    sflenqkptseeitmiadqlnmekevirvwfcnrrqkekrinp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqtB (B:)
    dleeleqfaktfkqrriklgftqgdvglamgklyndfsqttisrfealnlsfknmcklkp
    llekwlndaerkkrtsietnirvaleksflenqktseeitmiadqlnmekevirvwfcnr
    rqkekrinp
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.