PDB entry 1cqp

View 1cqp on RCSB PDB site
Description: crystal structure analysis of the complex lfa-1 (cd11a) i-domain / lovastatin at 2.6 a resolution
Deposited on 1999-08-10, released 2000-08-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-07, with a file datestamp of 2000-08-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1cqpa_
  • Chain 'B':
    Domains in SCOP 1.55: d1cqpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqpA (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqpB (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vi