PDB entry 1cqn

View 1cqn on RCSB PDB site
Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Class: ribosomal protein
Keywords: alzheimer disease, ribosomal protein s6, oligomerization
Deposited on 1999-08-08, released 2000-09-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • mutation (40-41)
    Domains in SCOPe 2.03: d1cqna_
  • Chain 'B':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • mutation (40-41)
    Domains in SCOPe 2.03: d1cqnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqnA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqnA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cqnB (B:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqnB (B:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepfl