PDB entry 1cqm

View 1cqm on RCSB PDB site
Description: protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Class: ribosomal protein
Keywords: alzheimer disease, ribosomal protein s6, oligomerization, ribosomal protein
Deposited on 1999-08-08, released 2000-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered mutation (40-41)
    Domains in SCOPe 2.08: d1cqma_
  • Chain 'B':
    Compound: ribosomal protein s6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered mutation (40-41)
    Domains in SCOPe 2.08: d1cqmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1cqmA (A:)
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

    Sequence, based on observed residues (ATOM records): (download) 
    >1cqmA (A:)
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1cqmB (B:)
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

    Sequence, based on observed residues (ATOM records): (download) 
    >1cqmB (B:)
mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepfl