PDB entry 1cqk

View 1cqk on RCSB PDB site
Description: crystal structure of the ch3 domain from the mak33 antibody
Class: immune system
Keywords: CONSTANT DOMAIN, C1-SUBSET, IMMUNOGLOBULIN, Immune system
Deposited on 1999-08-06, released 1999-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ch3 domain of mak33 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R1A4
      • mutation (1)
      • mutation (12)
      • mutation (19)
    Domains in SCOPe 2.07: d1cqka_
  • Chain 'B':
    Compound: ch3 domain of mak33 antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R1A4 (0-100)
      • mutation (1)
      • mutation (12)
      • mutation (19)
    Domains in SCOPe 2.07: d1cqkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqkA (A:)
    paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
    syfvysklnvqksnweagntftcsvlheglhnhhtekslsh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqkB (B:)
    paapqvytipppleqmakdlvsltcmitdffpeditvewqwngqpaenykntqpimdtdg
    syfvysklnvqksnweagntftcsvlheglhnhhtekslsh