PDB entry 1cqi

View 1cqi on RCSB PDB site
Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase
Deposited on 1999-08-06, released 2000-01-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-10, with a file datestamp of 2000-01-09.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.191
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiA (A:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiB (B:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiD (D:)
    silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
    aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
    pncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggd
    pipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapk
    gkrmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqiE (E:)
    mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
    kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
    vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
    fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqedp
    reaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkervte
    afkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelgakk
    ladsglniiaakgltdaaqqvvaav