PDB entry 1cqg

View 1cqg on RCSB PDB site
Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, 31 structures
Deposited on 1996-04-02, released 1996-08-01
The last revision prior to the SCOP 1.57 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1cqga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqgA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
    daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv