PDB entry 1cqf

View 1cqf on RCSB PDB site
Description: the complex of the mutated shiga toxin b subunit and gb3 trisaccharide
Class: toxin
Keywords: bacterial toxin, sugar receptor binding domain, protein-carbohydrate recognition, ob-fold
Deposited on 1999-08-06, released 2000-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (61)
    Domains in SCOPe 2.07: d1cqfa_
  • Chain 'B':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (61)
    Domains in SCOPe 2.07: d1cqfb_
  • Chain 'C':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (61)
    Domains in SCOPe 2.07: d1cqfc_
  • Chain 'D':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027
      • engineered (61)
    Domains in SCOPe 2.07: d1cqfd_
  • Chain 'E':
    Compound: shiga toxin b-chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08027 (0-68)
      • engineered (61)
    Domains in SCOPe 2.07: d1cqfe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqfA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqfB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqfC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqfD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cqfE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr