PDB entry 1cqe

View 1cqe on RCSB PDB site
Description: prostaglandin h2 synthase-1 complex with flurbiprofen
Class: oxidoreductase
Keywords: oxidoreductase, dioxygenase, peroxidase
Deposited on 1999-06-15, released 1999-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (prostaglandin h2 synthase-1)
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqea1, d1cqea2
  • Chain 'B':
    Compound: protein (prostaglandin h2 synthase-1)
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cqeb1, d1cqeb2
  • Heterogens: NAG, BOG, HEM, FLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1cqeA (A:)
    pvfsadpgapapvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrt
    tlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswe
    sfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaf
    faqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlnge
    vyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaeh
    ptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriame
    fnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrni
    dhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdida
    lefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvk
    tatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqeA (A:)
    pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfihf
    llthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytri
    lpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqffk
    tsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeapv
    lmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfqt
    arliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhplm
    pdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavdv
    ikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypglllek
    chpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcln
    tktcpyvsfhvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1cqeB (B:)
    pvfsadpgapapvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrt
    tlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswe
    sfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaf
    faqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlnge
    vyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaeh
    ptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriame
    fnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrni
    dhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdida
    lefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvk
    tatlkklvclntktcpyvsfhvpdprqedrpgverpptel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1cqeB (B:)
    apvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipeiwtwlrttlrpspsfih
    fllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptyniahdyiswesfsnvsyytr
    ilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqgtnlmfaffaqhfthqff
    ktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklkyqmlngevyppsveeap
    vlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvcdllkaehptwgdeqlfq
    tarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqyrnriamefnqlyhwhpl
    mpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagrigggrnidhhilhvavd
    vikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaeleelygdidalefypgllle
    kchpnsifgesmiemgapfslkgllgnpicspeywkastfggevgfnlvktatlkklvcl
    ntktcpyvsfhvp