PDB entry 1cq7

View 1cq7 on RCSB PDB site
Description: aspartate aminotransferase (e.c. 2.6.1.1) complexed with c5-pyridoxal-5p-phosphate
Class: transferase
Keywords: enzyme-substrate complex, transferase
Deposited on 1999-08-06, released 2000-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cq7a_
  • Heterogens: PY5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cq7A (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl